PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa018347
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 345aa    MW: 37812.3 Da    PI: 8.3932
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58690255PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-9947PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.4e-18169223256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+ +++k+q  +Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Lsa018347 169 RKKLRLSKDQAAVLEETFKEHNTLNPKQKLALAKQLDLRPRQVEVWFQNRRARTK 223
                788899***********************************************98 PP

2HD-ZIP_I/II127.55.5e-41169258191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlsk+q+++LEe+F+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++d+l+een+rL+kev+eLr +l
    Lsa018347 169 RKKLRLSKDQAAVLEETFKEHNTLNPKQKLALAKQLDLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCDTLTEENRRLQKEVNELR-AL 258
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.9E-221141IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.601.6E-18147223IPR009057Homeodomain-like
SuperFamilySSF466895.13E-18155226IPR009057Homeodomain-like
PROSITE profilePS5007117.135165225IPR001356Homeobox domain
SMARTSM003895.1E-15167229IPR001356Homeobox domain
CDDcd000861.12E-14169226No hitNo description
PfamPF000467.9E-16169223IPR001356Homeobox domain
PROSITE patternPS000270200223IPR017970Homeobox, conserved site
PfamPF021831.9E-11225259IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.5E-26225268IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGEKDDGLGL SLSLKCSENY PPPPPPPLTV VAGSNGATAT RFPLNLLPSP PLSFAQQRHH  60
VATNHQKLSF IINHAAPSSS SVLPPDLNAE TRSYSRGGID VNRLPSTSTL VALTAERDDE  120
ALVSSPNSTV SSVSGKRVER EENEAERESS SHGISGDDDD DGGEASAARK KLRLSKDQAA  180
VLEETFKEHN TLNPKQKLAL AKQLDLRPRQ VEVWFQNRRA RTKLKQTEVD CEYLKRCCDT  240
LTEENRRLQK EVNELRALKL SPQFYMNMNP PTTLTMCPQC ERVAVSSSSS SSSAAATSSA  300
VGSTGLPKAL HHGSMTANHQ KQNNPFLPRA TIIPHRPHEA HHPRW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1217225RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089804.11e-110PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotP466026e-87HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A103XI701e-160A0A103XI70_CYNCS; HD-ZIP protein, N-terminal
STRINGVIT_00s0299g00100.t012e-97(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44910.15e-64homeobox-leucine zipper protein 4